CDS

Accession Number TCMCG028C06141
gbkey CDS
Protein Id KAF6137086.1
Location complement(3845820..3846029)
Organism Kingdonia uniflora
locus_tag GIB67_030850

Protein

Length 69aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA587615, BioSample:SAMN13195877
db_source JACGCM010002660.1
Definition hypothetical protein GIB67_030850 [Kingdonia uniflora]
Locus_tag GIB67_030850

EGGNOG-MAPPER Annotation

COG_category P
Description May act as a component of the auxin efflux carrier
KEGG_TC 2.A.69.1
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko02000        [VIEW IN KEGG]
KEGG_ko ko:K13947        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0005215        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005886        [VIEW IN EMBL-EBI]
GO:0006810        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009914        [VIEW IN EMBL-EBI]
GO:0009926        [VIEW IN EMBL-EBI]
GO:0009966        [VIEW IN EMBL-EBI]
GO:0010252        [VIEW IN EMBL-EBI]
GO:0010315        [VIEW IN EMBL-EBI]
GO:0010329        [VIEW IN EMBL-EBI]
GO:0010646        [VIEW IN EMBL-EBI]
GO:0010817        [VIEW IN EMBL-EBI]
GO:0010928        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0015562        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0022857        [VIEW IN EMBL-EBI]
GO:0023051        [VIEW IN EMBL-EBI]
GO:0042592        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0048583        [VIEW IN EMBL-EBI]
GO:0048878        [VIEW IN EMBL-EBI]
GO:0050789        [VIEW IN EMBL-EBI]
GO:0050794        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051234        [VIEW IN EMBL-EBI]
GO:0055085        [VIEW IN EMBL-EBI]
GO:0060918        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0065008        [VIEW IN EMBL-EBI]
GO:0071944        [VIEW IN EMBL-EBI]
GO:0080161        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGCCTGCTATAATAGCATGCTCAATATCTATTCTATCAGATGCTGGTCTTGGTATGGCTATACTCAGTCTTGGTATGTTTATGGTATTGCAACTGTGTATTATTACTTCTGGAAACAAACTTGTTGACTTTACCATTTACCATGGATTTTTACGGTTCCTCGTTGGTCTTGCTGTCATTGCATTGACCTCCATTGCACTGGGATTATGA
Protein:  
MPAIIACSISILSDAGLGMAILSLGMFMVLQLCIITSGNKLVDFTIYHGFLRFLVGLAVIALTSIALGL